PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 318aa    MW: 35190 Da    PI: 5.0851
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.4e-10130179554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     kr++r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l   + 
  XP_013602035.1 130 KRAKRILANRQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 179
                     9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-16126190IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909128191IPR004827Basic-leucine zipper domain
PfamPF077161.3E-7128175IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-8130175No hitNo description
SuperFamilySSF579592.81E-10130181No hitNo description
CDDcd147038.94E-21131180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDKPDPPPNP NADPVPSSFH RRSRSDDMSM FMFTDPLSSA APPSSDDLPS DDDLFSSFID  60
VDSLSSNPDP PISFPDPSPA VPPSSSSRPR HRHSNSVDAG CAMYAGDEIM DAKKAMPPEK  120
LSELWSIDPK RAKRILANRQ SAARSKERKA RYIQELERRV QSLQTEATTL SAQLTLFQRD  180
TNGLANENTE LKMRLQAMEQ QAHLRNALNE ALRKEVERMK METGEISGNS DSFDMGMQQV  240
QYSPSTFMAI PPYHHGSINN GQDMQQMRGF NQMSNSQSVS EFLQNGRLQV LEISSNNSSG  300
LVKSEGPSLS GSESSSAY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0110015e-45AC011001.2 Arabidopsis thaliana chromosome I BAC F4H5 genomic sequence, complete sequence.
GenBankAJ4198525e-45AJ419852.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAJ4198535e-45AJ419853.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAY0624745e-45AY062474.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850; F4H5.7) mRNA, complete cds.
GenBankBT0001025e-45BT000102.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850) mRNA, complete cds.
GenBankCP0026845e-45CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602035.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P42e-80RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D3DJ680.0A0A0D3DJ68_BRAOL; Uncharacterized protein
STRINGBra030663.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-120basic leucine-zipper 52